Anti-ZNF177 ChIP certified

Product Overview

• Article Name: Anti-ZNF177 ChIP certified
• Biozol Catalog Number: ATA-HPA003141
• Supplier Catalog Number: HPA003141
• Alternative Catalog Number: ATA-HPA003141-100,ATA-HPA003141-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ZNF177

Product Description

zinc finger protein 177

Additional Information

Anti-ZNF177

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 7730
• UniProt: Q13360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: TWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTNCVRTHSGEMP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ZNF177
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemical staining of human testis shows weak to moderate nuclear and cytoplasmic positivity in a subset of cells in seminiferous ducts.

Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

HPA003141-100ul

HPA003141-100ul

HPA003141-100ul