Anti-MED12
Artikelnummer:
ATA-HPA003184
- Bilder (8)
| Artikelname: | Anti-MED12 |
| Artikelnummer: | ATA-HPA003184 |
| Hersteller Artikelnummer: | HPA003184 |
| Alternativnummer: | ATA-HPA003184-100,ATA-HPA003184-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAGH45, FGS1, HOPA, KIAA0192, OKS, OPA1, TNRC11, TRAP230 |
| mediator complex subunit 12 |
| Anti-MED12 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9968 |
| UniProt: | Q93074 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MED12 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, spleen and testis using Anti-MED12 antibody HPA003184 (A) shows similar protein distribution across tissues to independent antibody HPA003185 (B). |
|
|
Immunohistochemical staining of human testis using Anti-MED12 antibody HPA003184. |
|
|
Immunohistochemical staining of human colon using Anti-MED12 antibody HPA003184. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-MED12 antibody HPA003184. |
|
|
Immunohistochemical staining of human spleen using Anti-MED12 antibody HPA003184. |
|
|
HPA003184-100ul |
|
|
HPA003184-100ul |
|
|
HPA003184-100ul |
Produktgarantie und fachkundiger Support
