Anti-MED12
Catalog Number:
ATA-HPA003184
- Images (8)
| Article Name: | Anti-MED12 |
| Biozol Catalog Number: | ATA-HPA003184 |
| Supplier Catalog Number: | HPA003184 |
| Alternative Catalog Number: | ATA-HPA003184-100,ATA-HPA003184-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAGH45, FGS1, HOPA, KIAA0192, OKS, OPA1, TNRC11, TRAP230 |
| mediator complex subunit 12 |
| Anti-MED12 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9968 |
| UniProt: | Q93074 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MED12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, spleen and testis using Anti-MED12 antibody HPA003184 (A) shows similar protein distribution across tissues to independent antibody HPA003185 (B). |
|
|
Immunohistochemical staining of human testis using Anti-MED12 antibody HPA003184. |
|
|
Immunohistochemical staining of human colon using Anti-MED12 antibody HPA003184. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-MED12 antibody HPA003184. |
|
|
Immunohistochemical staining of human spleen using Anti-MED12 antibody HPA003184. |
|
|
HPA003184-100ul |
|
|
HPA003184-100ul |
|
|
HPA003184-100ul |
Product Guarantee and Expert Support
