Anti-GABPA
Artikelnummer:
ATA-HPA003258
- Bilder (8)
| Artikelname: | Anti-GABPA |
| Artikelnummer: | ATA-HPA003258 |
| Hersteller Artikelnummer: | HPA003258 |
| Alternativnummer: | ATA-HPA003258-100,ATA-HPA003258-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A |
| GA binding protein transcription factor, alpha subunit 60kDa |
| Anti-GABPA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2551 |
| UniProt: | Q06546 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GABPA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity in non-germinal center cells. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human liver tissue Lane 5: Human tonsil tissue |
|
|
HPA003258-100ul |
|
|
|
|
|
|
|
|
HPA003258-100ul |
|
|
HPA003258-100ul |
Produktgarantie und fachkundiger Support
