Anti-GABPA
Catalog Number:
ATA-HPA003258
- Images (8)
| Article Name: | Anti-GABPA |
| Biozol Catalog Number: | ATA-HPA003258 |
| Supplier Catalog Number: | HPA003258 |
| Alternative Catalog Number: | ATA-HPA003258-100,ATA-HPA003258-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A |
| GA binding protein transcription factor, alpha subunit 60kDa |
| Anti-GABPA |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 2551 |
| UniProt: | Q06546 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GABPA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity in non-germinal center cells. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human liver tissue Lane 5: Human tonsil tissue |
|
|
HPA003258-100ul |
|
|
|
|
|
|
|
|
HPA003258-100ul |
|
|
HPA003258-100ul |
Product Guarantee and Expert Support
