Anti-MITF Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003259
Artikelname: Anti-MITF Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003259
Hersteller Artikelnummer: HPA003259
Alternativnummer: ATA-HPA003259-100,ATA-HPA003259-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bHLHe32, MI, WS2, WS2A
microphthalmia-associated transcription factor
Anti-MITF
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 4286
UniProt: O75030
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MITF
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in cells in endometrial stroma.
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in melanocytes.
Immunohistochemical staining of human pancreas shows no positivity as expected.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-MITF antibody. Corresponding MITF RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis in control (vector only transfected HEK293T lysate) and MITF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404987).
HPA003259
HPA003259
HPA003259