Anti-MITF Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA003259
Article Name: Anti-MITF Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA003259
Supplier Catalog Number: HPA003259
Alternative Catalog Number: ATA-HPA003259-100,ATA-HPA003259-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ChIP, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bHLHe32, MI, WS2, WS2A
microphthalmia-associated transcription factor
Anti-MITF
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 4286
UniProt: O75030
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MITF
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in cells in endometrial stroma.
Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in melanocytes.
Immunohistochemical staining of human pancreas shows no positivity as expected.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-MITF antibody. Corresponding MITF RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis in control (vector only transfected HEK293T lysate) and MITF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404987).
HPA003259
HPA003259
HPA003259