Anti-PTP4A1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003281
Artikelname: Anti-PTP4A1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003281
Hersteller Artikelnummer: HPA003281
Alternativnummer: ATA-HPA003281-100,ATA-HPA003281-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PRL-1, PTPCAAX1
protein tyrosine phosphatase type IVA, member 1
Anti-PTP4A1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 7803
UniProt: Q93096
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human placenta shows distinct positivity in Hofbauer cells.