Anti-PTP4A1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PTP4A1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA003281
• Supplier Catalog Number: HPA003281
• Alternative Catalog Number: ATA-HPA003281-100,ATA-HPA003281-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: PRL-1, PTPCAAX1

Product Description

protein tyrosine phosphatase type IVA, member 1

Additional Information

Anti-PTP4A1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 7803
• UniProt: Q93096
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemical staining of human placenta shows distinct positivity in Hofbauer cells.