Anti-MOSPD2
Artikelnummer:
ATA-HPA003334
- Bilder (8)
| Artikelname: | Anti-MOSPD2 |
| Artikelnummer: | ATA-HPA003334 |
| Hersteller Artikelnummer: | HPA003334 |
| Alternativnummer: | ATA-HPA003334-100,ATA-HPA003334-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC26706 |
| motile sperm domain containing 2 |
| Anti-MOSPD2 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 158747 |
| UniProt: | Q8NHP6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SSKEDIESDGKETLETISNEEQTPLLKKINPTESTSKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MOSPD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
|
|
|
HPA003334-100ul |
|
|
HPA003334-100ul |
|
|
HPA003334-100ul |
Produktgarantie und fachkundiger Support
