Anti-MOSPD2
Catalog Number:
ATA-HPA003334
- Images (8)
| Article Name: | Anti-MOSPD2 |
| Biozol Catalog Number: | ATA-HPA003334 |
| Supplier Catalog Number: | HPA003334 |
| Alternative Catalog Number: | ATA-HPA003334-100,ATA-HPA003334-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC26706 |
| motile sperm domain containing 2 |
| Anti-MOSPD2 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 158747 |
| UniProt: | Q8NHP6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSKEDIESDGKETLETISNEEQTPLLKKINPTESTSKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MOSPD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
|
|
|
HPA003334-100ul |
|
|
HPA003334-100ul |
|
|
HPA003334-100ul |
Product Guarantee and Expert Support
