Anti-DUSP9
Artikelnummer:
ATA-HPA003336
- Bilder (6)
| Artikelname: | Anti-DUSP9 |
| Artikelnummer: | ATA-HPA003336 |
| Hersteller Artikelnummer: | HPA003336 |
| Alternativnummer: | ATA-HPA003336-100,ATA-HPA003336-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MKP-4, MKP4 |
| dual specificity phosphatase 9 |
| Anti-DUSP9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1852 |
| UniProt: | Q99956 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DUSP9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-DUSP9 antibody. Corresponding DUSP9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA003336-100ul |
|
|
HPA003336-100ul |
|
|
HPA003336-100ul |
Produktgarantie und fachkundiger Support
