Anti-DUSP9

Catalog Number: ATA-HPA003336
Article Name: Anti-DUSP9
Biozol Catalog Number: ATA-HPA003336
Supplier Catalog Number: HPA003336
Alternative Catalog Number: ATA-HPA003336-100,ATA-HPA003336-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MKP-4, MKP4
dual specificity phosphatase 9
Anti-DUSP9
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 1852
UniProt: Q99956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DUSP9
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-DUSP9 antibody. Corresponding DUSP9 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA003336-100ul
HPA003336-100ul
HPA003336-100ul