Anti-SH3KBP1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003351
Artikelname: Anti-SH3KBP1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003351
Hersteller Artikelnummer: HPA003351
Alternativnummer: ATA-HPA003351-100,ATA-HPA003351-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CIN85
SH3-domain kinase binding protein 1
Anti-SH3KBP1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 30011
UniProt: Q96B97
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SH3KBP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-SH3KBP1 antibody. Corresponding SH3KBP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis using Anti-SH3KBP1 antibody HPA003351 (A) shows similar pattern to independent antibody HPA003355 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA003351
HPA003351
HPA003351