Anti-SH3KBP1

Catalog Number: ATA-HPA003351
Article Name: Anti-SH3KBP1
Biozol Catalog Number: ATA-HPA003351
Supplier Catalog Number: HPA003351
Alternative Catalog Number: ATA-HPA003351-100,ATA-HPA003351-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CIN85
SH3-domain kinase binding protein 1
Anti-SH3KBP1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 30011
UniProt: Q96B97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SH3KBP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-SH3KBP1 antibody. Corresponding SH3KBP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis using Anti-SH3KBP1 antibody HPA003351 (A) shows similar pattern to independent antibody HPA003355 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA003351-100ul
HPA003351-100ul
HPA003351-100ul