Anti-SPTB

Artikelnummer: ATA-HPA003394
Artikelname: Anti-SPTB
Artikelnummer: ATA-HPA003394
Hersteller Artikelnummer: HPA003394
Alternativnummer: ATA-HPA003394-100,ATA-HPA003394-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SPTB
spectrin, beta, erythrocytic
Anti-SPTB
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 6710
UniProt: P11277
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SPTB
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-SPTB antibody. Corresponding SPTB RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA003394-100ul
HPA003394-100ul
HPA003394-100ul