Anti-SPTB

Catalog Number: ATA-HPA003394
Article Name: Anti-SPTB
Biozol Catalog Number: ATA-HPA003394
Supplier Catalog Number: HPA003394
Alternative Catalog Number: ATA-HPA003394-100,ATA-HPA003394-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SPTB
spectrin, beta, erythrocytic
Anti-SPTB
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 6710
UniProt: P11277
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SPTB
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-SPTB antibody. Corresponding SPTB RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA003394-100ul
HPA003394-100ul
HPA003394-100ul