Anti-PLAT
Artikelnummer:
ATA-HPA003412
- Bilder (6)
| Artikelname: | Anti-PLAT |
| Artikelnummer: | ATA-HPA003412 |
| Hersteller Artikelnummer: | HPA003412 |
| Alternativnummer: | ATA-HPA003412-100,ATA-HPA003412-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PLAT |
| plasminogen activator, tissue |
| Anti-PLAT |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5327 |
| UniProt: | P00750 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLAT |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong positivity in plasma. |
|
|
Immunohistochemical staining of human skin shows no cytoplasmic positivity in epidermal cells as expected. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong extracellular space positivity in cells in tubules. |
|
|
HPA003412-100ul |
|
|
HPA003412-100ul |
|
|
HPA003412-100ul |
Produktgarantie und fachkundiger Support
