Anti-PLAT
Catalog Number:
ATA-HPA003412
- Images (6)
| Article Name: | Anti-PLAT |
| Biozol Catalog Number: | ATA-HPA003412 |
| Supplier Catalog Number: | HPA003412 |
| Alternative Catalog Number: | ATA-HPA003412-100,ATA-HPA003412-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PLAT |
| plasminogen activator, tissue |
| Anti-PLAT |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5327 |
| UniProt: | P00750 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLAT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong positivity in plasma. |
|
|
Immunohistochemical staining of human skin shows no cytoplasmic positivity in epidermal cells as expected. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong extracellular space positivity in cells in tubules. |
|
|
HPA003412-100ul |
|
|
HPA003412-100ul |
|
|
HPA003412-100ul |
Product Guarantee and Expert Support
