Anti-SYNE2
Artikelnummer:
ATA-HPA003435
- Bilder (8)
| Artikelname: | Anti-SYNE2 |
| Artikelnummer: | ATA-HPA003435 |
| Hersteller Artikelnummer: | HPA003435 |
| Alternativnummer: | ATA-HPA003435-100,ATA-HPA003435-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZP434H2235, KIAA1011, Nesp2, Nesprin-2, NUA, NUANCE, SYNE-2 |
| spectrin repeat containing, nuclear envelope 2 |
| Anti-SYNE2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23224 |
| UniProt: | Q8WXH0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQEELESTVARIQDLTEKLGMISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETEAE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SYNE2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-SYNE2 antibody HPA003435 (A) shows similar protein distribution across tissues to independent antibody HPA050204 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-SYNE2 antibody HPA003435. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SYNE2 antibody HPA003435. |
|
|
Immunohistochemical staining of human testis using Anti-SYNE2 antibody HPA003435. |
|
|
Immunohistochemical staining of human colon using Anti-SYNE2 antibody HPA003435. |
|
|
HPA003435-100ul |
|
|
HPA003435-100ul |
|
|
HPA003435-100ul |
Produktgarantie und fachkundiger Support
