Anti-SYNE2
Catalog Number:
ATA-HPA003435
- Images (8)
| Article Name: | Anti-SYNE2 |
| Biozol Catalog Number: | ATA-HPA003435 |
| Supplier Catalog Number: | HPA003435 |
| Alternative Catalog Number: | ATA-HPA003435-100,ATA-HPA003435-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZP434H2235, KIAA1011, Nesp2, Nesprin-2, NUA, NUANCE, SYNE-2 |
| spectrin repeat containing, nuclear envelope 2 |
| Anti-SYNE2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 23224 |
| UniProt: | Q8WXH0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQEELESTVARIQDLTEKLGMISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETEAE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SYNE2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-SYNE2 antibody HPA003435 (A) shows similar protein distribution across tissues to independent antibody HPA050204 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-SYNE2 antibody HPA003435. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SYNE2 antibody HPA003435. |
|
|
Immunohistochemical staining of human testis using Anti-SYNE2 antibody HPA003435. |
|
|
Immunohistochemical staining of human colon using Anti-SYNE2 antibody HPA003435. |
|
|
HPA003435-100ul |
|
|
HPA003435-100ul |
|
|
HPA003435-100ul |
Product Guarantee and Expert Support
