Anti-ZEB2

Artikelnummer: ATA-HPA003456
Artikelname: Anti-ZEB2
Artikelnummer: ATA-HPA003456
Hersteller Artikelnummer: HPA003456
Alternativnummer: ATA-HPA003456-100,ATA-HPA003456-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ChIP, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0569, SIP-1, SIP1, ZFHX1B
zinc finger E-box binding homeobox 2
Anti-ZEB2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9839
UniProt: O60315
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ZEB2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells.
Immunohistochemical staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.
Immunohistochemical staining of human pancreas shows no positivity as expected.
Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
HPA003456-100ul
HPA003456-100ul
HPA003456-100ul