Anti-ZEB2 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA003456
Article Name: Anti-ZEB2 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA003456
Supplier Catalog Number: HPA003456
Alternative Catalog Number: ATA-HPA003456-100,ATA-HPA003456-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ChIP, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0569, SIP-1, SIP1, ZFHX1B
zinc finger E-box binding homeobox 2
Anti-ZEB2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9839
UniProt: O60315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ZEB2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells.
Immunohistochemical staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.
Immunohistochemical staining of human pancreas shows no positivity as expected.
Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
HPA003456
HPA003456
HPA003456