Anti-FCGBP Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA003564
Artikelname: Anti-FCGBP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA003564
Hersteller Artikelnummer: HPA003564
Alternativnummer: ATA-HPA003564-100,ATA-HPA003564-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FC(GAMMA)BP
Fc fragment of IgG binding protein
Anti-FCGBP
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 8857
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FCGBP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human colon and liver tissues using Anti-FCGBP antibody. Corresponding FCGBP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, kidney, liver and testis using Anti-FCGBP antibody HPA003564 (A) shows similar protein distribution across tissues to independent antibody HPA003517 (B).
Immunohistochemical staining of human colon shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human testis using Anti-FCGBP antibody HPA003564.
Immunohistochemical staining of human kidney using Anti-FCGBP antibody HPA003564.
HPA003564
HPA003564
HPA003564