Anti-FCGBP Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FCGBP Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA003564
• Supplier Catalog Number: HPA003564
• Alternative Catalog Number: ATA-HPA003564-100,ATA-HPA003564-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FC(GAMMA)BP

Product Description

Fc fragment of IgG binding protein

Additional Information

Anti-FCGBP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 8857
• UniProt: None
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FCGBP
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemistry analysis in human colon and liver tissues using Anti-FCGBP antibody. Corresponding FCGBP RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human colon, kidney, liver and testis using Anti-FCGBP antibody HPA003564 (A) shows similar protein distribution across tissues to independent antibody HPA003517 (B).

Immunohistochemical staining of human colon shows high expression.

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human testis using Anti-FCGBP antibody HPA003564.

Immunohistochemical staining of human kidney using Anti-FCGBP antibody HPA003564.

HPA003564

HPA003564

HPA003564