Anti-FCGBP

Catalog Number: ATA-HPA003564
Article Name: Anti-FCGBP
Biozol Catalog Number: ATA-HPA003564
Supplier Catalog Number: HPA003564
Alternative Catalog Number: ATA-HPA003564-100,ATA-HPA003564-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FC(GAMMA)BP
Fc fragment of IgG binding protein
Anti-FCGBP
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 8857
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LQAGDVVEFEVRPSWPLYLSANVGIQVLLFGTGAIRNEVTYDPYLVLIPDVAAYCPAYVVKSVPGCEGVALVVAQTKAISGLTIDGHAVGAKLTWEAVPGSEFSYAEVELGTADMIHTAEATTNLGLLT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FCGBP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human colon and liver tissues using Anti-FCGBP antibody. Corresponding FCGBP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, kidney, liver and testis using Anti-FCGBP antibody HPA003564 (A) shows similar protein distribution across tissues to independent antibody HPA003517 (B).
Immunohistochemical staining of human colon shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human testis using Anti-FCGBP antibody HPA003564.
Immunohistochemical staining of human kidney using Anti-FCGBP antibody HPA003564.
HPA003564-100ul
HPA003564-100ul
HPA003564-100ul