Anti-MAD1L1
Artikelnummer:
ATA-HPA003635
- Bilder (6)
| Artikelname: | Anti-MAD1L1 |
| Artikelnummer: | ATA-HPA003635 |
| Hersteller Artikelnummer: | HPA003635 |
| Alternativnummer: | ATA-HPA003635-100,ATA-HPA003635-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HsMAD1, MAD1, PIG9, TP53I9, TXBP181 |
| MAD1 mitotic arrest deficient-like 1 (yeast) |
| Anti-MAD1L1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8379 |
| UniProt: | Q9Y6D9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLEIRRAPPLSNN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MAD1L1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA003635-100ul |
|
|
|
|
|
HPA003635-100ul |
|
|
HPA003635-100ul |
Produktgarantie und fachkundiger Support
