Anti-MAD1L1
Catalog Number:
ATA-HPA003635
- Images (6)
| Article Name: | Anti-MAD1L1 |
| Biozol Catalog Number: | ATA-HPA003635 |
| Supplier Catalog Number: | HPA003635 |
| Alternative Catalog Number: | ATA-HPA003635-100,ATA-HPA003635-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HsMAD1, MAD1, PIG9, TP53I9, TXBP181 |
| MAD1 mitotic arrest deficient-like 1 (yeast) |
| Anti-MAD1L1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 8379 |
| UniProt: | Q9Y6D9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLEIRRAPPLSNN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MAD1L1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA003635-100ul |
|
|
|
|
|
HPA003635-100ul |
|
|
HPA003635-100ul |
Product Guarantee and Expert Support
