Anti-PAXBP1
Artikelnummer:
ATA-HPA003757
- Bilder (7)
| Artikelname: | Anti-PAXBP1 |
| Artikelnummer: | ATA-HPA003757 |
| Hersteller Artikelnummer: | HPA003757 |
| Alternativnummer: | ATA-HPA003757-100,ATA-HPA003757-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C21orf66, fSAP105, GCFC, GCFC1 |
| PAX3 and PAX7 binding protein 1 |
| Anti-PAXBP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 94104 |
| UniProt: | Q9Y5B6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ALSSLNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEKSQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PAXBP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells. |
|
|
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
|
|
|
HPA003757-100ul |
|
|
HPA003757-100ul |
|
|
HPA003757-100ul |
Produktgarantie und fachkundiger Support
