Anti-PAXBP1

Catalog Number: ATA-HPA003757
Article Name: Anti-PAXBP1
Biozol Catalog Number: ATA-HPA003757
Supplier Catalog Number: HPA003757
Alternative Catalog Number: ATA-HPA003757-100,ATA-HPA003757-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C21orf66, fSAP105, GCFC, GCFC1
PAX3 and PAX7 binding protein 1
Anti-PAXBP1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 94104
UniProt: Q9Y5B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALSSLNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEKSQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PAXBP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA003757-100ul
HPA003757-100ul
HPA003757-100ul