Anti-VSIG4

Artikelnummer: ATA-HPA003903
Artikelname: Anti-VSIG4
Artikelnummer: ATA-HPA003903
Hersteller Artikelnummer: HPA003903
Alternativnummer: ATA-HPA003903-100,ATA-HPA003903-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Z39IG
V-set and immunoglobulin domain containing 4
Anti-VSIG4
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 11326
UniProt: Q9Y279
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: VSIG4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA003903 antibody. Corresponding VSIG4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows moderate to strong positivity in Hofbauer cells.
Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Western blot analysis in human cell line Jurkat.
HPA003903-100ul
HPA003903-100ul
HPA003903-100ul