Anti-VSIG4
Catalog Number:
ATA-HPA003903
- Images (8)
| Article Name: | Anti-VSIG4 |
| Biozol Catalog Number: | ATA-HPA003903 |
| Supplier Catalog Number: | HPA003903 |
| Alternative Catalog Number: | ATA-HPA003903-100,ATA-HPA003903-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Z39IG |
| V-set and immunoglobulin domain containing 4 |
| Anti-VSIG4 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 11326 |
| UniProt: | Q9Y279 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VSIG4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA003903 antibody. Corresponding VSIG4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong positivity in Hofbauer cells. |
|
|
Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Western blot analysis in human cell line Jurkat. |
|
|
HPA003903-100ul |
|
|
HPA003903-100ul |
|
|
HPA003903-100ul |
Product Guarantee and Expert Support
