Anti-DYNLT3
Artikelnummer:
ATA-HPA003938
- Bilder (8)
| Artikelname: | Anti-DYNLT3 |
| Artikelnummer: | ATA-HPA003938 |
| Hersteller Artikelnummer: | HPA003938 |
| Alternativnummer: | ATA-HPA003938-100,ATA-HPA003938-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TCTE1L, TCTEX1L |
| dynein, light chain, Tctex-type 3 |
| Anti-DYNLT3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6990 |
| UniProt: | P51808 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DYNLT3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells, glial cells). |
|
|
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-DYNLT3 antibody. Corresponding DYNLT3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
|
|
HPA003938-100ul |
|
|
HPA003938-100ul |
|
|
HPA003938-100ul |
Produktgarantie und fachkundiger Support
