Anti-DYNLT3
Catalog Number:
ATA-HPA003938
- Images (8)
| Article Name: | Anti-DYNLT3 |
| Biozol Catalog Number: | ATA-HPA003938 |
| Supplier Catalog Number: | HPA003938 |
| Alternative Catalog Number: | ATA-HPA003938-100,ATA-HPA003938-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TCTE1L, TCTEX1L |
| dynein, light chain, Tctex-type 3 |
| Anti-DYNLT3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6990 |
| UniProt: | P51808 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DYNLT3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells, glial cells). |
|
|
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-DYNLT3 antibody. Corresponding DYNLT3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
|
|
HPA003938-100ul |
|
|
HPA003938-100ul |
|
|
HPA003938-100ul |
Product Guarantee and Expert Support
