Anti-HOXA6

Artikelnummer: ATA-HPA004203
Artikelname: Anti-HOXA6
Artikelnummer: ATA-HPA004203
Hersteller Artikelnummer: HPA004203
Alternativnummer: ATA-HPA004203-100,ATA-HPA004203-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HOX1, HOX1B
homeobox A6
Anti-HOXA6
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3203
UniProt: P31267
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HOXA6
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human skin shows weak nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human prostate shows weak to moderate nuclear positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and HOXA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411392).
HPA004203-100ul
HPA004203-100ul
HPA004203-100ul