Anti-HOXA6

Catalog Number: ATA-HPA004203
Article Name: Anti-HOXA6
Biozol Catalog Number: ATA-HPA004203
Supplier Catalog Number: HPA004203
Alternative Catalog Number: ATA-HPA004203-100,ATA-HPA004203-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HOX1, HOX1B
homeobox A6
Anti-HOXA6
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 3203
UniProt: P31267
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HOXA6
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human skin shows weak nuclear positivity in squamous epithelial cells.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human prostate shows weak to moderate nuclear positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and HOXA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411392).
HPA004203-100ul
HPA004203-100ul
HPA004203-100ul