Anti-AFG3L2
Artikelnummer:
ATA-HPA004480
- Bilder (8)
| Artikelname: | Anti-AFG3L2 |
| Artikelnummer: | ATA-HPA004480 |
| Hersteller Artikelnummer: | HPA004480 |
| Alternativnummer: | ATA-HPA004480-100,ATA-HPA004480-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SCA28, SPAX5 |
| AFG3-like AAA ATPase 2 |
| Anti-AFG3L2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10939 |
| UniProt: | Q9Y4W6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | AFG3L2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human colon, kidney, liver and testis using Anti-AFG3L2 antibody HPA004480 (A) shows similar protein distribution across tissues to independent antibody HPA004479 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-AFG3L2 antibody HPA004480. |
|
|
Immunohistochemical staining of human colon using Anti-AFG3L2 antibody HPA004480. |
|
|
Immunohistochemical staining of human testis using Anti-AFG3L2 antibody HPA004480. |
|
|
Immunohistochemical staining of human liver using Anti-AFG3L2 antibody HPA004480. |
|
|
HPA004480-100ul |
|
|
HPA004480-100ul |
|
|
HPA004480-100ul |
Produktgarantie und fachkundiger Support
