Anti-AFG3L2
Catalog Number:
ATA-HPA004480
- Images (8)
| Article Name: | Anti-AFG3L2 |
| Biozol Catalog Number: | ATA-HPA004480 |
| Supplier Catalog Number: | HPA004480 |
| Alternative Catalog Number: | ATA-HPA004480-100,ATA-HPA004480-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SCA28, SPAX5 |
| AFG3-like AAA ATPase 2 |
| Anti-AFG3L2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10939 |
| UniProt: | Q9Y4W6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AFG3L2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human colon, kidney, liver and testis using Anti-AFG3L2 antibody HPA004480 (A) shows similar protein distribution across tissues to independent antibody HPA004479 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-AFG3L2 antibody HPA004480. |
|
|
Immunohistochemical staining of human colon using Anti-AFG3L2 antibody HPA004480. |
|
|
Immunohistochemical staining of human testis using Anti-AFG3L2 antibody HPA004480. |
|
|
Immunohistochemical staining of human liver using Anti-AFG3L2 antibody HPA004480. |
|
|
HPA004480-100ul |
|
|
HPA004480-100ul |
|
|
HPA004480-100ul |
Product Guarantee and Expert Support
