Anti-MAGEC1
Artikelnummer:
ATA-HPA004622
- Bilder (7)
| Artikelname: | Anti-MAGEC1 |
| Artikelnummer: | ATA-HPA004622 |
| Hersteller Artikelnummer: | HPA004622 |
| Alternativnummer: | ATA-HPA004622-100,ATA-HPA004622-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CT7, CT7.1, MAGE-C1, MGC39366 |
| melanoma antigen family C, 1 |
| Anti-MAGEC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9947 |
| UniProt: | O60732 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MAGEC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using HPA004622 antibody. Corresponding MAGEC1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in spermatogonia. |
|
|
Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells. |
|
|
HPA004622-100ul |
|
|
|
|
|
HPA004622-100ul |
|
|
HPA004622-100ul |
Produktgarantie und fachkundiger Support
