Anti-MAGEC1
Catalog Number:
ATA-HPA004622
- Images (7)
| Article Name: | Anti-MAGEC1 |
| Biozol Catalog Number: | ATA-HPA004622 |
| Supplier Catalog Number: | HPA004622 |
| Alternative Catalog Number: | ATA-HPA004622-100,ATA-HPA004622-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CT7, CT7.1, MAGE-C1, MGC39366 |
| melanoma antigen family C, 1 |
| Anti-MAGEC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9947 |
| UniProt: | O60732 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MAGEC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using HPA004622 antibody. Corresponding MAGEC1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in spermatogonia. |
|
|
Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells. |
|
|
HPA004622-100ul |
|
|
|
|
|
HPA004622-100ul |
|
|
HPA004622-100ul |
Product Guarantee and Expert Support
