Anti-STRN3

Artikelnummer: ATA-HPA004636
Artikelname: Anti-STRN3
Artikelnummer: ATA-HPA004636
Hersteller Artikelnummer: HPA004636
Alternativnummer: ATA-HPA004636-100,ATA-HPA004636-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SG2NA
striatin, calmodulin binding protein 3
Anti-STRN3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 29966
UniProt: Q13033
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWAEPITFPSGGGKS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STRN3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Western blot analysis using Anti-STRN3 antibody HPA004636 (A) shows similar pattern to independent antibody HPA003392 (B).
HPA004636-100ul
HPA004636-100ul
HPA004636-100ul