Anti-STRN3

Catalog Number: ATA-HPA004636
Article Name: Anti-STRN3
Biozol Catalog Number: ATA-HPA004636
Supplier Catalog Number: HPA004636
Alternative Catalog Number: ATA-HPA004636-100,ATA-HPA004636-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SG2NA
striatin, calmodulin binding protein 3
Anti-STRN3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 29966
UniProt: Q13033
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWAEPITFPSGGGKS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STRN3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Western blot analysis using Anti-STRN3 antibody HPA004636 (A) shows similar pattern to independent antibody HPA003392 (B).
HPA004636-100ul
HPA004636-100ul
HPA004636-100ul