Anti-PECAM1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA004690
| Artikelname: |
Anti-PECAM1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA004690 |
| Hersteller Artikelnummer: |
HPA004690 |
| Alternativnummer: |
ATA-HPA004690-100,ATA-HPA004690-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Pan-Cancer |
| platelet/endothelial cell adhesion molecule 1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
5175 |
| UniProt: |
None |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
APPANFTIQKEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFEVIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVL |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
PECAM1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:100 - 1:500 |
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in epithelial cells. |
|
HPA004690 |