Anti-PECAM1

Artikelnummer: ATA-HPA004690
Artikelname: Anti-PECAM1
Artikelnummer: ATA-HPA004690
Hersteller Artikelnummer: HPA004690
Alternativnummer: ATA-HPA004690-100,ATA-HPA004690-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
platelet/endothelial cell adhesion molecule 1
Anti-PECAM1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5175
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: APPANFTIQKEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFEVIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PECAM1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:100 - 1:500
Immunohistochemical staining of human duodenum shows strong membranous positivity in epithelial cells.
HPA004690-100ul