Anti-PECAM1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004690
| Article Name: |
Anti-PECAM1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA004690 |
| Supplier Catalog Number: |
HPA004690 |
| Alternative Catalog Number: |
ATA-HPA004690-100,ATA-HPA004690-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
Pan-Cancer |
| platelet/endothelial cell adhesion molecule 1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 mg/ml |
| Isotype: |
IgG |
| NCBI: |
5175 |
| UniProt: |
None |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
APPANFTIQKEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFEVIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVL |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
PECAM1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:100 - 1:500 |
![]()
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in epithelial cells. |
![]()
|
HPA004690 |
