Anti-BARHL1 ChIP certified

Artikelnummer: ATA-HPA004809
Artikelname: Anti-BARHL1 ChIP certified
Artikelnummer: ATA-HPA004809
Hersteller Artikelnummer: HPA004809
Alternativnummer: ATA-HPA004809-100,ATA-HPA004809-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BARHL1
BarH-like homeobox 1
Anti-BARHL1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 56751
UniProt: Q9BZE3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BARHL1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in cells in molecular layer.
Immunohistochemical staining of human testis shows weak nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes.
HPA004809-100ul
HPA004809-100ul
HPA004809-100ul