Anti-BARHL1 ChIP certified
Catalog Number:
ATA-HPA004809
- Images (7)
| Article Name: | Anti-BARHL1 ChIP certified |
| Biozol Catalog Number: | ATA-HPA004809 |
| Supplier Catalog Number: | HPA004809 |
| Alternative Catalog Number: | ATA-HPA004809-100,ATA-HPA004809-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BARHL1 |
| BarH-like homeobox 1 |
| Anti-BARHL1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 56751 |
| UniProt: | Q9BZE3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BARHL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in cells in molecular layer. |
|
|
Immunohistochemical staining of human testis shows weak nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes. |
|
|
HPA004809-100ul |
|
|
HPA004809-100ul |
|
|
HPA004809-100ul |
Product Guarantee and Expert Support
