Anti-CDH1
Artikelnummer:
ATA-HPA004812
- Bilder (8)
| Artikelname: | Anti-CDH1 |
| Artikelnummer: | ATA-HPA004812 |
| Hersteller Artikelnummer: | HPA004812 |
| Alternativnummer: | ATA-HPA004812-100,ATA-HPA004812-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD324, UVO, uvomorulin |
| cadherin 1, type 1, E-cadherin (epithelial) |
| Anti-CDH1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 999 |
| UniProt: | P12830 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CDH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human colon and testis tissues using HPA004812 antibody. Corresponding CDH1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows moderate positivity in plasma membrane in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows moderate positivity in plasma membrane in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate positivity in plasma membrane of glandular cells. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
HPA004812-100ul |
|
|
HPA004812-100ul |
|
|
HPA004812-100ul |
Produktgarantie und fachkundiger Support
