Anti-CDH1
Catalog Number:
ATA-HPA004812
- Images (8)
| Article Name: | Anti-CDH1 |
| Biozol Catalog Number: | ATA-HPA004812 |
| Supplier Catalog Number: | HPA004812 |
| Alternative Catalog Number: | ATA-HPA004812-100,ATA-HPA004812-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD324, UVO, uvomorulin |
| cadherin 1, type 1, E-cadherin (epithelial) |
| Anti-CDH1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 999 |
| UniProt: | P12830 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CDH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human colon and testis tissues using HPA004812 antibody. Corresponding CDH1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows moderate positivity in plasma membrane in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows moderate positivity in plasma membrane in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate positivity in plasma membrane of glandular cells. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
HPA004812-100ul |
|
|
HPA004812-100ul |
|
|
HPA004812-100ul |
Product Guarantee and Expert Support
