Anti-FOSL2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004817
Artikelname: Anti-FOSL2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004817
Hersteller Artikelnummer: HPA004817
Alternativnummer: ATA-HPA004817-100,ATA-HPA004817-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ23306, FRA2
FOS-like antigen 2
Anti-FOSL2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 2355
UniProt: P15408
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FOSL2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human skin shows strong nuclear positivity in epidermal cells.
Western blot analysis in human cell lines U2OS and HEK293 using Anti-FOSL2 antibody. Corresponding FOSL2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA004817
HPA004817
HPA004817