Anti-FOSL2

Catalog Number: ATA-HPA004817
Article Name: Anti-FOSL2
Biozol Catalog Number: ATA-HPA004817
Supplier Catalog Number: HPA004817
Alternative Catalog Number: ATA-HPA004817-100,ATA-HPA004817-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ23306, FRA2
FOS-like antigen 2
Anti-FOSL2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 2355
UniProt: P15408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FOSL2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human skin shows strong nuclear positivity in epidermal cells.
Western blot analysis in human cell lines U2OS and HEK293 using Anti-FOSL2 antibody. Corresponding FOSL2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA004817-100ul
HPA004817-100ul
HPA004817-100ul