Anti-NNT

Artikelnummer: ATA-HPA004829
Artikelname: Anti-NNT
Artikelnummer: ATA-HPA004829
Hersteller Artikelnummer: HPA004829
Alternativnummer: ATA-HPA004829-100,ATA-HPA004829-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NNT
nicotinamide nucleotide transhydrogenase
Anti-NNT
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 23530
UniProt: Q13423
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NNT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-NNT antibody. Corresponding NNT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cell lines HeLa and U-251MG using Anti-NNT antibody. Corresponding NNT RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis in human cell line RH-30.
HPA004829-100ul
HPA004829-100ul
HPA004829-100ul